PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018180-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 191aa    MW: 21660 Da    PI: 10.2276
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018180-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++ +G g+W++ ++  g++R++k+c++rw +yl
  AHYPO_018180-RA 15 KGPWTPEEDHKLVSYIQNHGHGSWRALPKAAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding59.86.1e-1968113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  AHYPO_018180-RA  68 RGRFTQEEEDMIIKLHSVLGNK-WSRIAAHLP-GRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3791062IPR017930Myb domain
SuperFamilySSF466892.38E-3213109IPR009057Homeodomain-like
SMARTSM007177.4E-131464IPR001005SANT/Myb domain
PfamPF002494.0E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-251669IPR009057Homeodomain-like
CDDcd001671.24E-91762No hitNo description
PROSITE profilePS5129428.69463117IPR017930Myb domain
SMARTSM007178.8E-1867115IPR001005SANT/Myb domain
PfamPF002494.7E-1768113IPR001005SANT/Myb domain
CDDcd001674.71E-1370113No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2970117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGRSPCCNDI KELKKGPWTP EEDHKLVSYI QNHGHGSWRA LPKAAGLNRC GKSCRLRWTN  60
YLRPDIKRGR FTQEEEDMII KLHSVLGNKW SRIAAHLPGR TDNEIKNYWN THLRKKLLQM  120
GIDPVTHKPR SDLNLLANLS QLLTNPPNLG PLMNSWELNN ALRVQPNVAA ELTVYLVAAR  180
ASRVDTCMHG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30101172108B-MYB
1h8a_C5e-301211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695546.11e-114PREDICTED: transcription factor MYB39
SwissprotQ8GWP03e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0J8B8I51e-114A0A0J8B8I5_BETVU; Uncharacterized protein
STRINGGLYMA01G02070.23e-84(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.15e-80myb domain protein 107